LL-37
PH-LL37-001
Specifications
Description
LL-37 is a high-purity (≥99%) human cathelicidin antimicrobial peptide with a molecular weight of 4493.3 Da. The 37-amino acid sequence [LL-37, 37 aa] is studied in immunology and host defense research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining antimicrobial activity, immune modulation, and wound healing pathways.
Documentation
Storage and Handling
- ❄️ Store lyophilized peptide at -20°C or below
- 🔒 Protect from light and moisture
- 🌡️ Allow vial to reach room temperature before opening
- 💧 Reconstitute with appropriate sterile solvent
- 📦 Aliquot to avoid repeated freeze-thaw cycles
Research Overview
LL-37 is a synthetic peptide compound used in laboratory research settings. Researchers studying antimicrobial peptide activity use this compound to investigate cellular signaling pathways, receptor binding affinities, and structure-activity relationships. Each batch is manufactured under controlled conditions and verified through HPLC and mass spectrometry analysis to ensure consistency across experimental replicates.
Documentation & Resources
- Certificate of Analysis for LL-37 — batch-specific purity and identity verification
- Research Blog — protocols, guides, and peptide research literature
- Research Use Policy — handling and compliance guidelines
