LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino acid sequence with broad-spectrum antimicrobial and immunomodulatory properties. Our current lot, AM20260925-19, tested 99.772% HPLC purity with identity confirmed by Accumark Labs (report AJV5-KX4G, completed Sep 28, 2026)
Lot AM20260925-19
Tested on the 6.923 mg vial
Sample received Sep 24, 2026 · Analysis completed Sep 28, 2026
Conforms spec > 98.0%
Conforms
Measured
Figures copied exactly from Accumark Labs's report AJV5-KX4G.
Catalog no. PH-LL37-001Size 10mgMW (reference) 4,493 DaSequence [LL-37, 37 aa]
LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino acid sequence with broad-spectrum antimicrobial and immunomodulatory properties.
Mechanism of Action
LL-37 disrupts microbial membranes and modulates immune responses. Research demonstrates antimicrobial activity in platelets (PMID: 36769137) and roles in oral health (PMID: 41544412).
Research Applications
Product Specifications
References
LL-37 is supplied as a lyophilized powder. Keep it sealed, dry, and away from light until reconstitution.
Lyophilized material is stable when frozen. Once reconstituted, keep it cold and minimise handling to preserve integrity.
LL-37 is a synthetic peptide compound used in laboratory research settings. Researchers studying antimicrobial peptide activity use this compound to investigate cellular signaling pathways, receptor binding affinities, and structure-activity relationships. Its available Certificate of Analysis documents the reported laboratory results.
LL-37 is a research compound supplied for in-vitro laboratory use. Also known as LL37, Cathelicidin. Sequence: [LL-37, 37 aa] Supplied for antimicrobial laboratory research. A third-party Certificate of Analysis is published for the current lot. Research Use Only — not for human or veterinary use.
The current Certificate of Analysis for LL-37 reports 99.772% purity by HPLC (Accumark Labs report AJV5-KX4G).
Yes. Accumark Labs report AJV5-KX4G for LL-37 is on our COA page, with a link to the lab's own report.
LL-37 is supplied as a lyophilized powder. Store it at −20°C or below, protected from light and moisture — lyophilized material is stable frozen. Once reconstituted, keep it refrigerated and avoid freeze-thaw cycles.
Orders ship at a $15 flat rate, free on orders of $200 or more, in discreet, insulated packaging. Domestic delivery takes 2–3 business days — 2-day across California, nearby Nevada, and on orders of $250+.
No. LL-37 is supplied strictly for in-vitro laboratory research. It is not for human or veterinary use, consumption, or diagnostic or clinical applications.
Yes. LL-37 is also spelled or referred to as LL37, Cathelicidin. These are naming variants of the same compound, not different products.
LL-37's CAS Registry Number is 154947-66-7, per PubChem (CID 16198951).
Open the lab report link on our certificate page — it goes to Accumark Labs's own verification portal, not a file we host, so the result can't be edited by us. Confirm the report ID (AJV5-KX4G) and figures match what's shown here.
The 10mg size of LL-37 is $13.80 per mg. See the size selector above for per-mg pricing on every available size.
