Out of Stock

5-Amino-1MQ

PH-5A1MQ-001
$81.00
Purity≥99%
MW188.2 Da

5-Amino-1MQ is a high-purity (≥99%) small molecule NNMT inhibitor with a molecular weight of 188.2 Da. This research compound is studied for its role in nicotinamide N-methyltransferase pathway modulation and metabolic research applications. Supplied as a lyophilized powder, store at -20°C desiccated and protected from light. Ideal for in-vitro studies examining cellular metabolism, NAD+ salvage pathways, and energy homeostasis. For research use only.

ACE-031

PH-ACE031-001
$250.00
Purity≥95%
MW~110 kDa

ACE-031 is a research-grade ActRIIB-Fc fusion protein (≥95% purity) with a molecular weight of approximately 110 kDa. This soluble receptor decoy binds myostatin and activin, making it valuable for muscle biology and signaling pathway research. Supplied as a lyophilized powder, store at -20°C. Reconstitute with sterile water before use. Suitable for studies examining TGF-β superfamily signaling and muscle cell differentiation in controlled laboratory settings. For research use only.

Adipotide

PH-ADIP-001
$80.00
Purity≥99%
MW2465.8 Da

Adipotide is a high-purity (≥99%) peptidomimetic compound with a molecular weight of 2465.8 Da, featuring the sequence CKGGRAKDC-GG-KLAKLAKKLAKLAK. This dual-domain peptide combines a targeting motif with an effector sequence for adipose tissue research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for laboratory use. For research use only.

Out of Stock

AHK-Cu

PH-AHKCU-001
$40.00
Purity≥99%
MW467.0 Da

AHK-Cu (Copper Tripeptide-3) is a high-purity (≥99%) synthetic copper-peptide complex with a molecular weight of 467.0 Da. Comprising the sequence Ala-His-Lys chelated with copper, this compound is studied in skin biology and extracellular matrix research. Supplied as a light blue crystalline powder, store at 2-8°C protected from moisture. Ideal for in-vitro studies examining collagen synthesis and tissue remodeling pathways. For research use only.

AICAR

PH-AICAR-001
From $80.00
Purity≥99%
MW258.2 Da

AICAR (5-Aminoimidazole-4-carboxamide ribonucleoside) is a high-purity (≥99%) AMPK activator with a molecular weight of 258.2 Da and molecular formula C9H14N4O5. This adenosine analog serves as a valuable tool for metabolic pathway research and cellular energy sensing studies. Supplied as a crystalline powder, store at -20°C desiccated. Widely used in studies examining glucose uptake, fatty acid oxidation, and metabolic regulation. For research use only.

Out of Stock

AOD-9604 2mg

PH-AOD-001-2MG
$20.00
Purity≥99%
MW1817.1 Da

AOD-9604 is a high-purity (≥99%) synthetic peptide fragment derived from the C-terminal region of human growth hormone, with a molecular weight of 1817.1 Da. The 16-amino acid sequence (Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe) is studied in lipolysis and metabolic research. Supplied lyophilized, store at -20°C. Reconstitute with bacteriostatic water. For research use only.

Out of Stock

AOD-9604 5mg

PH-AOD-001-5MG
$40.00
Purity≥99%
MW1817.1 Da

AOD-9604 is a high-purity (≥99%) synthetic peptide fragment derived from the C-terminal region of human growth hormone, with a molecular weight of 1817.1 Da. The 16-amino acid sequence (Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe) is studied in lipolysis and metabolic research. Supplied lyophilized, store at -20°C. Reconstitute with bacteriostatic water. For research use only.

ARA-290

PH-ARA290-001
From $50.00
Purity≥99%
MW1257.5 Da

ARA-290 is a high-purity (≥99%) erythropoietin-derived peptide with a molecular weight of 1257.5 Da. This 11-amino acid sequence (pGlu-Glu-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-NH2) selectively targets the innate repair receptor and is studied in tissue protection and neuroprotection research. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for cytoprotection studies. For research use only.

BAC Water 10ml

PH-00002P-010
From $10.00
PurityUSP Grade
MWH₂O + 0.9% BA

USP-grade Bacteriostatic Water (10ml) is an essential reconstitution solution for peptide research. Contains 0.9% benzyl alcohol as a preservative, allowing multiple uses from a single vial. This sterile, pyrogen-free water is the standard diluent for reconstituting lyophilized peptides in laboratory settings. Store at room temperature protected from light. Compatible with most research peptides and proteins. Proudly distributed by verified US supplier BAC SUPPLY CO. For research use only.

BAC Water 30ml

PH-022218-030
From $20.00
PurityUSP Grade
MWH₂O + 0.9% BA

Premium reconstitution solution for precise peptide dilutions. Features 7X ultra-filtered bacteriostatic water in a 30ml borosilicate glass vial with premium flip cap top and self-healing butyl rubber stopper for secure and repeated access. Borosilicate glass offers the lightest, strongest, and most chemically and heat-resistant glass for laboratory use. Made in USA by BAC Supply Co. Proud distributor - verified distributor of BAC SUPPLY CO located in the USA

BPC-157

PH-BPC157-001
From $24.95
Purity99.564%
MW1419.5 Da

BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide derived from human gastric juice proteins. This 15-amino acid sequence has become one of the most studied peptides in tissue repair and regeneration research. Key specifications: • Purity: 99.564% (HPLC verified) • Molecular Weight: 1419.5 Da • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val • Form: Lyophilized powder • Storage: -20°C Research applications include gastric tissue studies, angiogenesis research, and wound healing models. BPC-157 demonstrates remarkable stability in various pH conditions, making it suitable for diverse experimental protocols. Each order includes batch-specific Certificate of Analysis. For research purposes only.

Out of Stock

BPC-157 + TB-500 10mg

PH-BPCTB-001-10MG
$65.00
Purity≥99%
MWBlend

BPC-157 + TB-500 Blend is a high-purity (≥99%) combination of two complementary tissue repair peptides. This synergistic formulation combines Body Protection Compound-157 with Thymosin Beta-4 fragment for enhanced regenerative research applications. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water before use. Ideal for studying tissue healing cascades and cellular repair mechanisms. For research use only.

Out of Stock

BPC-157 + TB-500 5/5mg

PH-BPCTB-001-5/5MG
$45.00
Purity≥99%
MWBlend

BPC-157 + TB-500 Blend is a high-purity (≥99%) combination of two complementary tissue repair peptides. This synergistic formulation combines Body Protection Compound-157 with Thymosin Beta-4 fragment for enhanced regenerative research applications. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water before use. Ideal for studying tissue healing cascades and cellular repair mechanisms. For research use only.

Cerebrolysin

PH-CERE-001
From $40.00
Purity≥99%
MWPeptide mixture

Cerebrolysin is a high-purity (≥99%) neuropeptide preparation derived from porcine brain tissue, containing a complex mixture of low molecular weight peptides and free amino acids. This research compound is studied for its neurotrophic properties in neurological research applications. Currently ON BACKORDER (4-6 week arrival). Store at 2-8°C protected from light. Used in studies examining neuroplasticity and neuroprotection. For research use only.

CJC-1295

PH-CJC1295-001
From $45.00
Purity≥99%
MW3367.9 Da

CJC-1295 is a high-purity (≥99%) synthetic 30-amino acid peptide analog of growth hormone-releasing hormone (GHRH) with a molecular weight of 3367.9 Da. Modified for enhanced stability, this research compound is studied in growth hormone axis and neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for laboratory studies. For research use only.

CJC-1295 + Ipamorelin Blend

PH-CJCIPA-001
From $55.00
Purity≥99%
MWBlend

CJC-1295 + Ipamorelin Blend is a high-purity (≥99%) combination of GHRH analog and GHRP for synergistic growth hormone research. This dual-mechanism formulation combines the sustained GHRH activity of CJC-1295 with the selective ghrelin receptor agonism of Ipamorelin. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for studying GH secretion pathways and pituitary function. For research use only.

Dihexa

PH-DIHEX-001
From $80.00
Purity≥99%
MW323.4 Da

Dihexa is a high-purity (≥99%) small molecule peptide with a molecular weight of 323.4 Da, featuring a hexanoic-Tyr-Ile-(6) aminohexanoic amide structure. This potent HGF/MET receptor agonist is studied in cognitive and neurotrophic research. Supplied as a lyophilized powder, store at -20°C desiccated and protected from light. Used in studies examining synaptic plasticity, memory formation, and neuronal growth. For research use only.

DSIP

PH-DSIP-001
$80.00
Purity≥99%
MW848.8 Da

DSIP (Delta Sleep-Inducing Peptide) is a high-purity (≥99%) nonapeptide with a molecular weight of 848.8 Da. The sequence Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu is studied in circadian rhythm, sleep physiology, and neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water for laboratory studies examining sleep architecture and stress response. For research use only.

Epithalon

PH-EPITH-001
$45.00
Purity≥99%
MW390.3 Da

Epithalon (Epitalon) is a high-purity (≥99%) synthetic tetrapeptide with a molecular weight of 390.3 Da, featuring the sequence Ala-Glu-Asp-Gly. This research compound is studied for its role in telomerase activation and aging research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for in-vitro studies examining cellular senescence, telomere biology, and longevity pathways. For research use only.

Out of Stock

Follistatin-344

PH-FST344
From $299.99
Purity≥98%
MW~38 kDa

Follistatin-344 is a research-grade recombinant protein (≥98% purity) with a molecular weight of approximately 38 kDa. This activin-binding protein isoform is studied in muscle biology and myostatin inhibition research. Supplied as a lyophilized powder, store at -20°C. Reconstitute with sterile water and use immediately. Ideal for studies examining TGF-β pathway regulation and muscle cell differentiation. For research use only.

FOXO4-DRI

PH-FOXO4-001
$255.00
Purity≥99%
MW3400 Da

FOXO4-DRI is a high-purity (≥99%) D-retro-inverso peptide with a molecular weight of 3400 Da. This cell-penetrating peptide disrupts FOXO4-p53 interactions and is studied in cellular senescence and aging research. Supplied as a lyophilized powder, store at -20°C protected from light. The D-amino acid configuration provides enhanced protease resistance. Used for senolytic pathway research. For research use only.

GHK-Cu

PH-GHKCU-001
From $35.00
Purity≥99%
MW403.9 Da

GHK-Cu (Copper Tripeptide-1) is a high-purity (≥99%) copper-peptide complex with a molecular weight of 403.9 Da. The sequence Gly-His-Lys chelated with copper(II) is extensively studied in wound healing, tissue repair, and skin biology research. Supplied as a blue crystalline powder, store at 2-8°C protected from moisture. Ideal for in-vitro studies examining collagen synthesis and extracellular matrix remodeling. For research use only.

GHRP-2

PH-GHRP2-001
$50.00
Purity≥99%
MW817.9 Da

GHRP-2 (Growth Hormone Releasing Peptide-2) is a high-purity (≥99%) hexapeptide with a molecular weight of 817.9 Da. The sequence D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2 acts as a potent ghrelin receptor agonist for growth hormone research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water. Used in pituitary function and GH secretion studies. For research use only.

GHRP-6

PH-GHRP6-001
$50.00
Purity≥99%
MW873.0 Da

GHRP-6 (Growth Hormone Releasing Peptide-6) is a high-purity (≥99%) hexapeptide with a molecular weight of 873.0 Da. The sequence His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 is a potent ghrelin receptor agonist studied in growth hormone secretion research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for laboratory use in GH axis studies. For research use only.

Glow

PH-GLOWPB-01
From $100.00
PurityGHK-Cu: 59mg | BPC-157: 10.5mg | TB-500: 10.7mg | KPV: 14.2mg
MWBlend

Glow is a high-purity multi-peptide research blend containing GHK-Cu (59mg), BPC-157 (10.5mg), TB-500 (10.7mg), and KPV (14.2mg). This proprietary formulation combines complementary peptides for comprehensive skin and tissue research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for studying synergistic effects on extracellular matrix, tissue repair, and skin biology. For research use only.

Out of Stock

Glutathione

PH-GLUT-001
$90.00
Purity≥99%
MW307.3 Da

Glutathione is a high-purity (≥99%) tripeptide antioxidant with a molecular weight of 307.3 Da. The sequence L-glutamyl-L-cysteinyl-glycine is the body's master antioxidant, studied in cellular oxidative stress and redox biology research. Supplied as a white crystalline powder, store at -20°C protected from light and moisture. Essential for studies examining reactive oxygen species, detoxification pathways, and cellular protection. For research use only.

Out of Stock

Gonadorelin

PH-GONA-001
From $29.99
Purity≥99%
MW1182.3 Da

Gonadorelin is a high-purity (≥99%) decapeptide with a molecular weight of 1182.3 Da. The sequence pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 is the natural gonadotropin-releasing hormone (GnRH) for reproductive endocrinology research. Supplied as a lyophilized powder, store at -20°C protected from light. Used in studies examining pituitary-gonadal axis function and hormone secretion. For research use only.

Hexarelin

PH-HEX-001
$45.00
Purity≥99%
MW887.0 Da

Hexarelin is a high-purity (≥99%) growth hormone secretagogue with a molecular weight of 887.0 Da. The sequence His-D-2MeTrp-Ala-Trp-D-Phe-Lys-NH2 is one of the most potent GHRPs for growth hormone research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water. Ideal for pituitary function and GH pathway studies. For research use only.

Out of Stock

HGH Fragment 176-191

PH-FRAG-001
From $39.99
Purity≥99%
MW1817.1 Da

HGH Fragment 176-191 is a high-purity (≥99%) synthetic peptide with a molecular weight of 1817.1 Da. This 16-amino acid sequence (Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe) represents the lipolytic region of human growth hormone. Supplied as a lyophilized powder, store at -20°C. Used in fat metabolism and metabolic research applications. For research use only.

Humanin

PH-HUM-001
From $150.00
Purity≥99%
MW2687.2 Da

Humanin is a high-purity (≥99%) mitochondrial-derived peptide with a molecular weight of 2687.2 Da. The 24-amino acid sequence MAPRGFSCLLLLTSEIDLPVKRRA is studied in cytoprotection, neuroprotection, and longevity research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining mitochondrial signaling, apoptosis regulation, and cellular stress responses. For research use only.

IGF-1 DES

PH-IGFDES-001
From $129.99
Purity≥99%
MW7365.4 Da

IGF-1 DES is a high-purity (≥99%) truncated insulin-like growth factor-1 with a molecular weight of 7365.4 Da. This 67-amino acid variant lacks the N-terminal tripeptide, resulting in enhanced receptor binding activity. Supplied as a lyophilized powder, store at -20°C protected from light. Used in growth factor receptor research and cellular proliferation studies. For research use only.

IGF-1 LR3

PH-IGF1LR3-001
$80.00
Purity≥99%
MW9111.0 Da

IGF-1 LR3 (Long R3 IGF-1) is a high-purity (≥99%) modified insulin-like growth factor-1 with a molecular weight of 9111.0 Da. This 83-amino acid sequence features an Arg3 substitution and 13-amino acid N-terminal extension for enhanced stability. Supplied lyophilized, store at -20°C. Used in growth factor signaling and cellular proliferation research. For research use only.

Ipamorelin

PH-IPAM-001
$60.00
Purity≥99%
MW711.9 Da

Ipamorelin is a high-purity (≥99%) selective growth hormone secretagogue with a molecular weight of 711.9 Da. The pentapeptide sequence Aib-His-D-2Nal-D-Phe-Lys-NH2 selectively stimulates GH release with minimal effect on other hormones. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water. Ideal for studying GH pathway specificity. For research use only.

Kisspeptin

PH-KISS-001
$55.00
Purity99.2%
MW1302.50 Da

Kisspeptin is a peptide hormone encoded by the KISS1 gene that plays a fundamental role in reproductive hormone regulation and gonadotropin-releasing hormone (GnRH) secretion. Research indicates kisspeptin may influence reproductive function, hormone balance, and sexual behavior. This research-grade peptide is provided for laboratory investigation and educational purposes only.

KLOW

PH-KLOW-001
$145.00
Purity≥99%
MWSee documentation

KLOW is a high-purity (≥99%) advanced regenerative research formula featuring a proprietary peptide blend. This multi-component formulation is designed for comprehensive metabolic and cellular regeneration studies. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water before laboratory use. Ideal for studying synergistic peptide effects. For research use only.

KPV Peptide

PH-KPV-001
From $89.99
Purity≥99%
MW357.4 Da

KPV is a high-purity (≥99%) tripeptide with a molecular weight of 357.4 Da, featuring the sequence Lys-Pro-Val. This C-terminal fragment of alpha-melanocyte stimulating hormone (α-MSH) is studied in inflammation and immune modulation research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining melanocortin signaling and anti-inflammatory pathways in laboratory settings. For research use only.

L-Carnitine

PH-LCAR-001
$65.00
Purity99%
MW161.2 Da

L-Carnitine is a high-purity (99%) quaternary ammonium compound with a molecular weight of 161.2 Da and molecular formula C7H15NO3. This amino acid derivative plays a crucial role in fatty acid transport and energy metabolism research. Supplied as a crystalline powder, store at room temperature in a dry location. Essential for studies examining mitochondrial function and cellular bioenergetics. For research use only.

Lipo-C Formula

PH-LIPOC-001
$95.00
Purity≥99%
MWComplex formulation

Lipo-C Formula is a high-purity (≥99%) metabolic research blend containing L-Carnitine, L-Arginine, Methionine, Inositol, and Choline. This multi-component formulation combines lipotropic factors for comprehensive metabolic pathway research. Supplied as a lyophilized powder, store at -20°C protected from moisture. Ideal for studying fat metabolism, liver function, and cellular energy pathways. For research use only.

LL-37

PH-LL37-001
$125.00
Purity≥99%
MW4493.3 Da

LL-37 is a high-purity (≥99%) human cathelicidin antimicrobial peptide with a molecular weight of 4493.3 Da. The 37-amino acid sequence [LL-37, 37 aa] is studied in immunology and host defense research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining antimicrobial activity, immune modulation, and wound healing pathways. For research use only.

Melanotan I

PH-MT1-001
$45.00
Purity≥99%
MW1646.8 Da

Melanotan I (Afamelanotide) is a high-purity (≥99%) synthetic α-MSH analog with a molecular weight of 1646.8 Da. The 13-amino acid sequence Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2 is studied in melanogenesis and melanocortin receptor research. Supplied lyophilized, store at -20°C protected from light. Used for pigmentation and photoprotection studies. For research use only.

Melanotan II

PH-MT2-001
$45.00
Purity≥99%
MW1024.2 Da

Melanotan II is a high-purity (≥99%) cyclic melanocortin receptor agonist with a molecular weight of 1024.2 Da. The sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2 binds multiple MC receptors for pigmentation and neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water. Used in melanocortin system studies. For research use only.

MGF

PH-MGF-001
From $80.00
Purity≥99%
MW2867.4 Da

MGF (Mechano Growth Factor) is a high-purity (≥99%) peptide with a molecular weight of 2867.4 Da. This IGF-1Ec splice variant is studied in muscle satellite cell activation and tissue repair research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining exercise-induced growth factor expression and muscle regeneration pathways. For research use only.

Out of Stock

Mod GRF 1-29

PH-MODGRF-001
From $34.95
Purity≥99%
MW3367.9 Da

Mod GRF 1-29 (CJC-1295 without DAC) is a high-purity (≥99%) modified growth hormone-releasing hormone analog with a molecular weight of 3367.9 Da. This tetrasubstituted 29-amino acid peptide offers enhanced stability over native GHRH. Supplied as a lyophilized powder, store at -20°C. Reconstitute with bacteriostatic water. Used in GH axis and pulsatile release research. For research use only.

MOTS-c

PH-MOTSC-001
From $59.99
Purity99.789%
MW2174.6 Da

MOTS-c is an exceptionally pure (99.789%) mitochondrial-derived peptide with a molecular weight of 2174.6 Da. The 16-amino acid sequence MRWQEMGYIFYPRKLR is encoded in mitochondrial DNA and studied in metabolic regulation and longevity research. Supplied lyophilized, store at -20°C protected from light. Used for examining exercise mimetics and metabolic homeostasis. For research use only.

NAD+

PH-NAD-001
From $60.00
PurityN/A
MW663.4 Da

NAD+ (Nicotinamide Adenine Dinucleotide) is a critical coenzyme found in all living cells, essential for cellular energy metabolism and DNA repair mechanisms. Our research-grade NAD+ provides high-purity material for longevity and cellular metabolism studies. Key specifications: • Purity: 100% (HPLC verified) • Molecular Weight: 663.4 Da • Form: Lyophilized powder • Storage: -20°C, desiccated NAD+ research applications include sirtuin activation studies, mitochondrial function analysis, and age-related metabolic research. The compound plays a central role in redox reactions and serves as a substrate for NAD-consuming enzymes. Certificate of Analysis included. For research purposes only.

PE-22-28

PH-PE2228-001
$60.00
Purity≥99%
MW758.9 Da

PE-22-28 is a high-purity (≥99%) Spadin analog with a molecular weight of 758.9 Da. This heptapeptide TREK-1 channel blocker is studied in cognitive enhancement and mood regulation research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water. Used for examining potassium channel modulation and neuroplasticity. For research use only.

Out of Stock

PEG-MGF

PH-PEGMGF-001
From $99.99
Purity≥99%
MW~5000 Da

PEG-MGF (PEGylated Mechano Growth Factor) is a high-purity (≥99%) modified peptide with a molecular weight of approximately 5000 Da. The polyethylene glycol conjugation extends biological half-life for sustained research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Used in muscle biology and growth factor signaling studies requiring prolonged activity. For research use only.

Pinealon

PH-PIN-001
From $59.95
Purity≥99%
MW357.4 Da

Pinealon is a high-purity (≥99%) tripeptide with a molecular weight of 357.4 Da, featuring the sequence Glu-Asp-Arg. This synthetic peptide is studied in cognitive function, neuroprotection, and pineal gland research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining neuronal function and circadian regulation pathways. For research use only.

PT-141 (Bremelanotide)

PH-PT141-001
$55.00
Purity≥99%
MW1025.2 Da

PT-141 (Bremelanotide) is a high-purity (≥99%) cyclic melanocortin receptor agonist with a molecular weight of 1025.2 Da. The sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH activates MC3R and MC4R for neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light. Used in melanocortin pathway and central nervous system studies. For research use only.

Out of Stock

Retatrutide 10mg

PH-RETA-001-10MG
$120.00
Purity99.579%
MW~4700 Da

Retatrutide is a novel triple-agonist peptide targeting GLP-1, GIP, and glucagon receptors simultaneously. This investigational compound represents a breakthrough in metabolic research, with clinical studies showing significant effects on body composition and metabolic markers. Key specifications: • Purity: 99.579% (HPLC verified) • Molecular Weight: ~4700 Da • Form: Lyophilized powder • Storage: -20°C, protected from light Retatrutide's unique triple-receptor mechanism makes it a valuable research tool for studying metabolic pathways, appetite regulation, and energy homeostasis. Each vial includes a Certificate of Analysis with third-party verification. For research use only. Not for human consumption.

Out of Stock

Retatrutide 20mg

PH-RETA-001-20MG
$200.00
Purity99.579%
MW~4700 Da

Retatrutide is a novel triple-agonist peptide targeting GLP-1, GIP, and glucagon receptors simultaneously. This investigational compound represents a breakthrough in metabolic research, with clinical studies showing significant effects on body composition and metabolic markers. Key specifications: • Purity: 99.579% (HPLC verified) • Molecular Weight: ~4700 Da • Form: Lyophilized powder • Storage: -20°C, protected from light Retatrutide's unique triple-receptor mechanism makes it a valuable research tool for studying metabolic pathways, appetite regulation, and energy homeostasis. Each vial includes a Certificate of Analysis with third-party verification. For research use only. Not for human consumption.

Out of Stock

Retatrutide 30mg

PH-RETA-001-30MG
$250.00
Purity99.579%
MW~4700 Da

Retatrutide is a novel triple-agonist peptide targeting GLP-1, GIP, and glucagon receptors simultaneously. This investigational compound represents a breakthrough in metabolic research, with clinical studies showing significant effects on body composition and metabolic markers. Key specifications: • Purity: 99.579% (HPLC verified) • Molecular Weight: ~4700 Da • Form: Lyophilized powder • Storage: -20°C, protected from light Retatrutide's unique triple-receptor mechanism makes it a valuable research tool for studying metabolic pathways, appetite regulation, and energy homeostasis. Each vial includes a Certificate of Analysis with third-party verification. For research use only. Not for human consumption.

Selank

PH-SELANK-001
$45.00
Purity99.885%
MW751.9 Da

Selank is an exceptionally pure (99.885%) synthetic heptapeptide with a molecular weight of 751.9 Da. The sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro is a Tuftsin analog studied in anxiolytic and immunomodulatory research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining neuropeptide signaling and immune function pathways. For research use only.

Out of Stock

Semaglutide 10mg

PH-SEMA-001-10MG
$100.00
Purity99.982%
MW4113.6 Da

Semaglutide is a GLP-1 receptor agonist peptide widely used in metabolic and endocrine research. This 31-amino acid peptide features modifications that extend its research utility, including an acylated lysine residue for enhanced stability. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4113.6 Da • Form: Lyophilized powder • Storage: -20°C, protected from light Research applications include glucose-dependent insulin secretion studies, appetite regulation mechanisms, and comparative pharmacology with other incretin mimetics. Semaglutide's prolonged activity profile makes it valuable for extended observation protocols. Third-party tested with Certificate of Analysis. For research use only.

Out of Stock

Semaglutide 5mg

PH-SEMA-001-5MG
$75.00
Purity99.982%
MW4113.6 Da

Semaglutide is a GLP-1 receptor agonist peptide widely used in metabolic and endocrine research. This 31-amino acid peptide features modifications that extend its research utility, including an acylated lysine residue for enhanced stability. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4113.6 Da • Form: Lyophilized powder • Storage: -20°C, protected from light Research applications include glucose-dependent insulin secretion studies, appetite regulation mechanisms, and comparative pharmacology with other incretin mimetics. Semaglutide's prolonged activity profile makes it valuable for extended observation protocols. Third-party tested with Certificate of Analysis. For research use only.

Semax

PH-SEMAX-001
From $45.00
Purity99.341%
MW813.9 Da

Semax is an exceptionally pure (99.341%) synthetic heptapeptide with a molecular weight of 813.9 Da. The sequence Met-Glu-His-Phe-Pro-Gly-Pro is an ACTH(4-7) analog studied in cognitive enhancement and neuroprotection research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining neurotrophic factor expression and memory formation. For research use only.

Out of Stock

Sermorelin

PH-SERM-001
From $50.00
Purity≥99%
MW3357.9 Da

Sermorelin is a high-purity (≥99%) synthetic GHRH(1-29)NH2 analog with a molecular weight of 3357.9 Da. This 29-amino acid peptide represents the bioactive portion of native growth hormone-releasing hormone. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for endocrine research examining GH axis function. For research use only.

Out of Stock

SLU-PP-332

PH-SLUPP-001
From $60.00
Purity≥99%
MWSee documentation

SLU-PP-332 is a high-purity (≥99%) small molecule ERRα/γ agonist studied in metabolic and exercise mimetic research. This compound activates estrogen-related receptors involved in mitochondrial biogenesis and energy metabolism. Supplied as a powder, store at -20°C desiccated and protected from light. Used for examining exercise-induced gene expression and metabolic adaptation pathways. For research use only.

SNAP-8

PH-SNAP8-001
From $35.00
Purity≥99%
MW1075.2 Da

SNAP-8 (Acetyl Octapeptide-3) is a high-purity (≥99%) synthetic peptide with a molecular weight of 1075.2 Da. The sequence Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2 modulates SNARE complex formation for neuromuscular junction research. Supplied as a lyophilized powder, store at -20°C protected from moisture. Used in cosmetic and neurobiology research applications. For research use only.

SS-31 (Elamipretide)

PH-SS31-001
From $50.00
Purity99.163%
MW639.8 Da

SS-31 (Elamipretide) is an exceptionally pure (99.163%) mitochondria-targeted tetrapeptide with a molecular weight of 639.8 Da. The sequence D-Arg-Dmt-Lys-Phe-NH2 localizes to the inner mitochondrial membrane for cellular energy research. Supplied lyophilized, store at -20°C protected from light. Used for examining mitochondrial function and cardiolipin interactions. For research use only.

Super MIC B12

PH-MICB12
$100.00
Purity≥98%
MWCompound Blend

Super MIC B12 is a research-grade (≥98% purity) compound blend combining lipotropic factors with vitamin B12 for metabolic research applications. This multi-component formulation supports studies in fat metabolism, methylation, and cellular energy production. Supplied as a lyophilized preparation, store at 2-8°C protected from light. Ideal for examining lipotropic pathways and metabolic function. For research use only.

Out of Stock

Syn-Ake

PH-SYNAKE-001
$89.98
Purity≥99%
MW474.6 Da

Syn-Ake is a high-purity (≥99%) dipeptide with a molecular weight of 474.6 Da. This Waglerin-1 mimetic (dipeptide diaminobutyroyl benzylamide diacetate) is studied in neuromuscular junction and acetylcholine receptor research. Supplied as a powder, store at -20°C protected from moisture. Used in cosmetic science and neurobiology research examining muscle contraction modulation. For research use only.

TB-500

PH-TB500-001
$80.00
Purity99.487%
MW4963.4 Da

TB-500 is an exceptionally pure (99.487%) synthetic peptide with a molecular weight of 4963.4 Da. This 43-amino acid Thymosin Beta-4 fragment contains the Ac-SDKP active sequence studied in tissue repair and regeneration research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining wound healing, angiogenesis, and cellular migration pathways. For research use only.

Tesamorelin

PH-TESA-001
$85.00
Purity99.72%
MW5135.9 Da

Tesamorelin is an exceptionally pure (99.72%) modified GHRH analog with a molecular weight of 5135.9 Da. The sequence trans-3-hexenoic acid-GHRH(1-44)NH2 features enhanced stability for growth hormone axis and metabolic research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for lipodystrophy and endocrine studies. For research use only.

Tesamorelin 10mg + Ipamorelin 5mg

PH-TESA-IPA-001
$110.00
Purity99%+
MW5135.9 Da / 711.85 Da

Tesamorelin + Ipamorelin Blend (99%+ purity) combines 10mg Tesamorelin (5135.9 Da) with 5mg Ipamorelin (711.85 Da) for enhanced growth hormone research. This synergistic formulation pairs a long-acting GHRH analog with a selective GHRP for comprehensive GH axis studies. Supplied lyophilized, store at -20°C protected from light. Reconstitute with bacteriostatic water for pituitary function research. For research use only.

Thymosin Alpha-1

PH-TA1-001
$75.00
Purity≥99%
MW3108.3 Da

Thymosin Alpha-1 is a high-purity (≥99%) 28-amino acid thymic peptide with a molecular weight of 3108.3 Da. The sequence Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN is studied in immunomodulation and immune system research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining T-cell function and immune response pathways. For research use only.

Thymulin

PH-THYM-001
$55.00
Purity≥99%
MW847.9 Da

Thymulin is a high-purity (≥99%) thymic nonapeptide with a molecular weight of 847.9 Da. The sequence pGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn requires zinc for biological activity and is studied in immune system research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining T-cell differentiation and thymic function pathways. For research use only.

Out of Stock

Tirzepatide 10mg

PH-TIRZ-001-10MG
$100.00
Purity99.505%
MW4813.5 Da

Tirzepatide is a dual GIP/GLP-1 receptor agonist peptide used extensively in metabolic and endocrine research. This 39-amino acid synthetic peptide represents a significant advancement in incretin-based research compounds. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4813.5 Da • Form: Lyophilized powder • Storage: -20°C, protected from light The dual-agonist mechanism allows researchers to study synergistic effects of GIP and GLP-1 receptor activation on glucose metabolism, insulin secretion, and appetite signaling pathways. Tirzepatide has become essential for comparative studies in metabolic research. Includes Certificate of Analysis. For research use only.

Out of Stock

Tirzepatide 15mg

PH-TIRZ-001-15MG
$140.00
Purity99.505%
MW4813.5 Da

Tirzepatide is a dual GIP/GLP-1 receptor agonist peptide used extensively in metabolic and endocrine research. This 39-amino acid synthetic peptide represents a significant advancement in incretin-based research compounds. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4813.5 Da • Form: Lyophilized powder • Storage: -20°C, protected from light The dual-agonist mechanism allows researchers to study synergistic effects of GIP and GLP-1 receptor activation on glucose metabolism, insulin secretion, and appetite signaling pathways. Tirzepatide has become essential for comparative studies in metabolic research. Includes Certificate of Analysis. For research use only.

Out of Stock

Tirzepatide 20mg

PH-TIRZ-001-20MG
$180.00
Purity99.505%
MW4813.5 Da

Tirzepatide is a dual GIP/GLP-1 receptor agonist peptide used extensively in metabolic and endocrine research. This 39-amino acid synthetic peptide represents a significant advancement in incretin-based research compounds. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4813.5 Da • Form: Lyophilized powder • Storage: -20°C, protected from light The dual-agonist mechanism allows researchers to study synergistic effects of GIP and GLP-1 receptor activation on glucose metabolism, insulin secretion, and appetite signaling pathways. Tirzepatide has become essential for comparative studies in metabolic research. Includes Certificate of Analysis. For research use only.

Out of Stock

Tirzepatide 30mg

PH-TIRZ-001-30MG
$250.00
Purity99.505%
MW4813.5 Da

Tirzepatide is a dual GIP/GLP-1 receptor agonist peptide used extensively in metabolic and endocrine research. This 39-amino acid synthetic peptide represents a significant advancement in incretin-based research compounds. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4813.5 Da • Form: Lyophilized powder • Storage: -20°C, protected from light The dual-agonist mechanism allows researchers to study synergistic effects of GIP and GLP-1 receptor activation on glucose metabolism, insulin secretion, and appetite signaling pathways. Tirzepatide has become essential for comparative studies in metabolic research. Includes Certificate of Analysis. For research use only.

Tirzepatide 40mg

PH-TIRZ-40MG
$300.00
Purity99.505%
MW4813.5 Da

Tirzepatide is a dual GIP/GLP-1 receptor agonist peptide used extensively in metabolic and endocrine research. This 39-amino acid synthetic peptide represents a significant advancement in incretin-based research compounds. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4813.5 Da • Form: Lyophilized powder • Storage: -20°C, protected from light The dual-agonist mechanism allows researchers to study synergistic effects of GIP and GLP-1 receptor activation on glucose metabolism, insulin secretion, and appetite signaling pathways. Tirzepatide has become essential for comparative studies in metabolic research. Includes Certificate of Analysis. For research use only.

VIP

PH-VIP-001
$75.00
Purity≥99%
MW3326.8 Da

VIP (Vasoactive Intestinal Peptide) is a high-purity (≥99%) 28-amino acid neuropeptide with a molecular weight of 3326.8 Da. This regulatory peptide is studied in neuroendocrine, gastrointestinal, and immune function research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining vasodilation, circadian rhythms, and neurotransmitter pathways. For research use only.

Research Use Notice

All products are supplied exclusively for laboratory research purposes. These materials are not intended for human or veterinary use, diagnostic procedures, or clinical applications. Researchers must ensure compliance with applicable institutional and regulatory requirements.