All Products

ACE-031 is a research-grade ActRIIB-Fc fusion protein (≥95% purity) with a molecular weight of approximately 110 kDa. This soluble receptor decoy binds myostatin and activin, making it valuable for muscle biology and signaling pathway research. Supplied as a lyophilized powder, store at -20°C. Reconstitute with sterile water before use. Suitable for studies examining TGF-β superfamily signaling and muscle cell differentiation in controlled laboratory settings. For research use only.

Adipotide is a high-purity (≥99%) peptidomimetic compound with a molecular weight of 2465.8 Da, featuring the sequence CKGGRAKDC-GG-KLAKLAKKLAKLAK. This dual-domain peptide combines a targeting motif with an effector sequence for adipose tissue research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for laboratory use. For research use only.

AICAR (5-Aminoimidazole-4-carboxamide ribonucleoside) is a high-purity (≥99%) AMPK activator with a molecular weight of 258.2 Da and molecular formula C9H14N4O5. This adenosine analog serves as a valuable tool for metabolic pathway research and cellular energy sensing studies. Supplied as a crystalline powder, store at -20°C desiccated. Widely used in studies examining glucose uptake, fatty acid oxidation, and metabolic regulation. For research use only.

ARA-290 is a high-purity (≥99%) erythropoietin-derived peptide with a molecular weight of 1257.5 Da. This 11-amino acid sequence (pGlu-Glu-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-NH2) selectively targets the innate repair receptor and is studied in tissue protection and neuroprotection research. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for cytoprotection studies. For research use only.

USP-grade Bacteriostatic Water (10ml) is an essential reconstitution solution for peptide research. Contains 0.9% benzyl alcohol as a preservative, allowing multiple uses from a single vial. This sterile, pyrogen-free water is the standard diluent for reconstituting lyophilized peptides in laboratory settings. Store at room temperature protected from light. Compatible with most research peptides and proteins. Proudly distributed by verified US supplier BAC SUPPLY CO. For research use only.

Premium reconstitution solution for precise peptide dilutions. Features 7X ultra-filtered bacteriostatic water in a 30ml borosilicate glass vial with premium flip cap top and self-healing butyl rubber stopper for secure and repeated access. Borosilicate glass offers the lightest, strongest, and most chemically and heat-resistant glass for laboratory use. Made in USA by BAC Supply Co. Proud distributor - verified distributor of BAC SUPPLY CO located in the USA

BPC-157 (Body Protection Compound-157) is a synthetic pentadecapeptide derived from human gastric juice proteins. This 15-amino acid sequence has become one of the most studied peptides in tissue repair and regeneration research. Key specifications: • Purity: 99.564% (HPLC verified) • Molecular Weight: 1419.5 Da • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val • Form: Lyophilized powder • Storage: -20°C Research applications include gastric tissue studies, angiogenesis research, and wound healing models. BPC-157 demonstrates remarkable stability in various pH conditions, making it suitable for diverse experimental protocols. Each order includes batch-specific Certificate of Analysis. For research purposes only.

Cerebrolysin is a high-purity (≥99%) neuropeptide preparation derived from porcine brain tissue, containing a complex mixture of low molecular weight peptides and free amino acids. This research compound is studied for its neurotrophic properties in neurological research applications. Currently ON BACKORDER (4-6 week arrival). Store at 2-8°C protected from light. Used in studies examining neuroplasticity and neuroprotection. For research use only.

CJC-1295 is a high-purity (≥99%) synthetic 30-amino acid peptide analog of growth hormone-releasing hormone (GHRH) with a molecular weight of 3367.9 Da. Modified for enhanced stability, this research compound is studied in growth hormone axis and neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for laboratory studies. For research use only.

CJC-1295 + Ipamorelin Blend is a high-purity (≥99%) combination of GHRH analog and GHRP for synergistic growth hormone research. This dual-mechanism formulation combines the sustained GHRH activity of CJC-1295 with the selective ghrelin receptor agonism of Ipamorelin. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for studying GH secretion pathways and pituitary function. For research use only.

Dihexa is a high-purity (≥99%) small molecule peptide with a molecular weight of 323.4 Da, featuring a hexanoic-Tyr-Ile-(6) aminohexanoic amide structure. This potent HGF/MET receptor agonist is studied in cognitive and neurotrophic research. Supplied as a lyophilized powder, store at -20°C desiccated and protected from light. Used in studies examining synaptic plasticity, memory formation, and neuronal growth. For research use only.

DSIP (Delta Sleep-Inducing Peptide) is a high-purity (≥99%) nonapeptide with a molecular weight of 848.8 Da. The sequence Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu is studied in circadian rhythm, sleep physiology, and neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water for laboratory studies examining sleep architecture and stress response. For research use only.

Epithalon (Epitalon) is a high-purity (≥99%) synthetic tetrapeptide with a molecular weight of 390.3 Da, featuring the sequence Ala-Glu-Asp-Gly. This research compound is studied for its role in telomerase activation and aging research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for in-vitro studies examining cellular senescence, telomere biology, and longevity pathways. For research use only.

FOXO4-DRI is a high-purity (≥99%) D-retro-inverso peptide with a molecular weight of 3400 Da. This cell-penetrating peptide disrupts FOXO4-p53 interactions and is studied in cellular senescence and aging research. Supplied as a lyophilized powder, store at -20°C protected from light. The D-amino acid configuration provides enhanced protease resistance. Used for senolytic pathway research. For research use only.

GHK-Cu (Copper Tripeptide-1) is a high-purity (≥99%) copper-peptide complex with a molecular weight of 403.9 Da. The sequence Gly-His-Lys chelated with copper(II) is extensively studied in wound healing, tissue repair, and skin biology research. Supplied as a blue crystalline powder, store at 2-8°C protected from moisture. Ideal for in-vitro studies examining collagen synthesis and extracellular matrix remodeling. For research use only.

GHRP-2 (Growth Hormone Releasing Peptide-2) is a high-purity (≥99%) hexapeptide with a molecular weight of 817.9 Da. The sequence D-Ala-D-2Nal-Ala-Trp-D-Phe-Lys-NH2 acts as a potent ghrelin receptor agonist for growth hormone research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water. Used in pituitary function and GH secretion studies. For research use only.

GHRP-6 (Growth Hormone Releasing Peptide-6) is a high-purity (≥99%) hexapeptide with a molecular weight of 873.0 Da. The sequence His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 is a potent ghrelin receptor agonist studied in growth hormone secretion research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for laboratory use in GH axis studies. For research use only.

Glow is a high-purity multi-peptide research blend containing GHK-Cu (59mg), BPC-157 (10.5mg), TB-500 (10.7mg), and KPV (14.2mg). This proprietary formulation combines complementary peptides for comprehensive skin and tissue research applications. Supplied as a lyophilized powder, store at -20°C protected from light. Ideal for studying synergistic effects on extracellular matrix, tissue repair, and skin biology. For research use only.

Hexarelin is a high-purity (≥99%) growth hormone secretagogue with a molecular weight of 887.0 Da. The sequence His-D-2MeTrp-Ala-Trp-D-Phe-Lys-NH2 is one of the most potent GHRPs for growth hormone research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water. Ideal for pituitary function and GH pathway studies. For research use only.

Humanin is a high-purity (≥99%) mitochondrial-derived peptide with a molecular weight of 2687.2 Da. The 24-amino acid sequence MAPRGFSCLLLLTSEIDLPVKRRA is studied in cytoprotection, neuroprotection, and longevity research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining mitochondrial signaling, apoptosis regulation, and cellular stress responses. For research use only.

IGF-1 DES is a high-purity (≥99%) truncated insulin-like growth factor-1 with a molecular weight of 7365.4 Da. This 67-amino acid variant lacks the N-terminal tripeptide, resulting in enhanced receptor binding activity. Supplied as a lyophilized powder, store at -20°C protected from light. Used in growth factor receptor research and cellular proliferation studies. For research use only.

IGF-1 LR3 (Long R3 IGF-1) is a high-purity (≥99%) modified insulin-like growth factor-1 with a molecular weight of 9111.0 Da. This 83-amino acid sequence features an Arg3 substitution and 13-amino acid N-terminal extension for enhanced stability. Supplied lyophilized, store at -20°C. Used in growth factor signaling and cellular proliferation research. For research use only.

Ipamorelin is a high-purity (≥99%) selective growth hormone secretagogue with a molecular weight of 711.9 Da. The pentapeptide sequence Aib-His-D-2Nal-D-Phe-Lys-NH2 selectively stimulates GH release with minimal effect on other hormones. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water. Ideal for studying GH pathway specificity. For research use only.

Kisspeptin is a peptide hormone encoded by the KISS1 gene that plays a fundamental role in reproductive hormone regulation and gonadotropin-releasing hormone (GnRH) secretion. Research indicates kisspeptin may influence reproductive function, hormone balance, and sexual behavior. This research-grade peptide is provided for laboratory investigation and educational purposes only.

KLOW is a high-purity (≥99%) advanced regenerative research formula featuring a proprietary peptide blend. This multi-component formulation is designed for comprehensive metabolic and cellular regeneration studies. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water before laboratory use. Ideal for studying synergistic peptide effects. For research use only.

KPV is a high-purity (≥99%) tripeptide with a molecular weight of 357.4 Da, featuring the sequence Lys-Pro-Val. This C-terminal fragment of alpha-melanocyte stimulating hormone (α-MSH) is studied in inflammation and immune modulation research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining melanocortin signaling and anti-inflammatory pathways in laboratory settings. For research use only.

L-Carnitine is a high-purity (99%) quaternary ammonium compound with a molecular weight of 161.2 Da and molecular formula C7H15NO3. This amino acid derivative plays a crucial role in fatty acid transport and energy metabolism research. Supplied as a crystalline powder, store at room temperature in a dry location. Essential for studies examining mitochondrial function and cellular bioenergetics. For research use only.

Lipo-C Formula is a high-purity (≥99%) metabolic research blend containing L-Carnitine, L-Arginine, Methionine, Inositol, and Choline. This multi-component formulation combines lipotropic factors for comprehensive metabolic pathway research. Supplied as a lyophilized powder, store at -20°C protected from moisture. Ideal for studying fat metabolism, liver function, and cellular energy pathways. For research use only.

LL-37 is a high-purity (≥99%) human cathelicidin antimicrobial peptide with a molecular weight of 4493.3 Da. The 37-amino acid sequence [LL-37, 37 aa] is studied in immunology and host defense research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining antimicrobial activity, immune modulation, and wound healing pathways. For research use only.

Melanotan I (Afamelanotide) is a high-purity (≥99%) synthetic α-MSH analog with a molecular weight of 1646.8 Da. The 13-amino acid sequence Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2 is studied in melanogenesis and melanocortin receptor research. Supplied lyophilized, store at -20°C protected from light. Used for pigmentation and photoprotection studies. For research use only.

Melanotan II is a high-purity (≥99%) cyclic melanocortin receptor agonist with a molecular weight of 1024.2 Da. The sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2 binds multiple MC receptors for pigmentation and neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water. Used in melanocortin system studies. For research use only.

MGF (Mechano Growth Factor) is a high-purity (≥99%) peptide with a molecular weight of 2867.4 Da. This IGF-1Ec splice variant is studied in muscle satellite cell activation and tissue repair research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining exercise-induced growth factor expression and muscle regeneration pathways. For research use only.

MOTS-c is an exceptionally pure (99.789%) mitochondrial-derived peptide with a molecular weight of 2174.6 Da. The 16-amino acid sequence MRWQEMGYIFYPRKLR is encoded in mitochondrial DNA and studied in metabolic regulation and longevity research. Supplied lyophilized, store at -20°C protected from light. Used for examining exercise mimetics and metabolic homeostasis. For research use only.

NAD+ (Nicotinamide Adenine Dinucleotide) is a critical coenzyme found in all living cells, essential for cellular energy metabolism and DNA repair mechanisms. Our research-grade NAD+ provides high-purity material for longevity and cellular metabolism studies. Key specifications: • Purity: 100% (HPLC verified) • Molecular Weight: 663.4 Da • Form: Lyophilized powder • Storage: -20°C, desiccated NAD+ research applications include sirtuin activation studies, mitochondrial function analysis, and age-related metabolic research. The compound plays a central role in redox reactions and serves as a substrate for NAD-consuming enzymes. Certificate of Analysis included. For research purposes only.

PE-22-28 is a high-purity (≥99%) Spadin analog with a molecular weight of 758.9 Da. This heptapeptide TREK-1 channel blocker is studied in cognitive enhancement and mood regulation research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Reconstitute with bacteriostatic water. Used for examining potassium channel modulation and neuroplasticity. For research use only.

Pinealon is a high-purity (≥99%) tripeptide with a molecular weight of 357.4 Da, featuring the sequence Glu-Asp-Arg. This synthetic peptide is studied in cognitive function, neuroprotection, and pineal gland research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining neuronal function and circadian regulation pathways. For research use only.

PT-141 (Bremelanotide) is a high-purity (≥99%) cyclic melanocortin receptor agonist with a molecular weight of 1025.2 Da. The sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH activates MC3R and MC4R for neuroendocrine research. Supplied as a lyophilized powder, store at -20°C protected from light. Used in melanocortin pathway and central nervous system studies. For research use only.

Selank is an exceptionally pure (99.885%) synthetic heptapeptide with a molecular weight of 751.9 Da. The sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro is a Tuftsin analog studied in anxiolytic and immunomodulatory research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining neuropeptide signaling and immune function pathways. For research use only.

Semax is an exceptionally pure (99.341%) synthetic heptapeptide with a molecular weight of 813.9 Da. The sequence Met-Glu-His-Phe-Pro-Gly-Pro is an ACTH(4-7) analog studied in cognitive enhancement and neuroprotection research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining neurotrophic factor expression and memory formation. For research use only.

SNAP-8 (Acetyl Octapeptide-3) is a high-purity (≥99%) synthetic peptide with a molecular weight of 1075.2 Da. The sequence Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2 modulates SNARE complex formation for neuromuscular junction research. Supplied as a lyophilized powder, store at -20°C protected from moisture. Used in cosmetic and neurobiology research applications. For research use only.

SS-31 (Elamipretide) is an exceptionally pure (99.163%) mitochondria-targeted tetrapeptide with a molecular weight of 639.8 Da. The sequence D-Arg-Dmt-Lys-Phe-NH2 localizes to the inner mitochondrial membrane for cellular energy research. Supplied lyophilized, store at -20°C protected from light. Used for examining mitochondrial function and cardiolipin interactions. For research use only.

Super MIC B12 is a research-grade (≥98% purity) compound blend combining lipotropic factors with vitamin B12 for metabolic research applications. This multi-component formulation supports studies in fat metabolism, methylation, and cellular energy production. Supplied as a lyophilized preparation, store at 2-8°C protected from light. Ideal for examining lipotropic pathways and metabolic function. For research use only.

TB-500 is an exceptionally pure (99.487%) synthetic peptide with a molecular weight of 4963.4 Da. This 43-amino acid Thymosin Beta-4 fragment contains the Ac-SDKP active sequence studied in tissue repair and regeneration research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining wound healing, angiogenesis, and cellular migration pathways. For research use only.

Tesamorelin is an exceptionally pure (99.72%) modified GHRH analog with a molecular weight of 5135.9 Da. The sequence trans-3-hexenoic acid-GHRH(1-44)NH2 features enhanced stability for growth hormone axis and metabolic research. Supplied as a lyophilized powder, store at -20°C protected from light. Reconstitute with bacteriostatic water for lipodystrophy and endocrine studies. For research use only.

Tesamorelin + Ipamorelin Blend (99%+ purity) combines 10mg Tesamorelin (5135.9 Da) with 5mg Ipamorelin (711.85 Da) for enhanced growth hormone research. This synergistic formulation pairs a long-acting GHRH analog with a selective GHRP for comprehensive GH axis studies. Supplied lyophilized, store at -20°C protected from light. Reconstitute with bacteriostatic water for pituitary function research. For research use only.

Thymosin Alpha-1 is a high-purity (≥99%) 28-amino acid thymic peptide with a molecular weight of 3108.3 Da. The sequence Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN is studied in immunomodulation and immune system research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining T-cell function and immune response pathways. For research use only.

Thymulin is a high-purity (≥99%) thymic nonapeptide with a molecular weight of 847.9 Da. The sequence pGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn requires zinc for biological activity and is studied in immune system research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining T-cell differentiation and thymic function pathways. For research use only.

Tirzepatide is a dual GIP/GLP-1 receptor agonist peptide used extensively in metabolic and endocrine research. This 39-amino acid synthetic peptide represents a significant advancement in incretin-based research compounds. Key specifications: • Purity: 99% (HPLC verified) • Molecular Weight: 4813.5 Da • Form: Lyophilized powder • Storage: -20°C, protected from light The dual-agonist mechanism allows researchers to study synergistic effects of GIP and GLP-1 receptor activation on glucose metabolism, insulin secretion, and appetite signaling pathways. Tirzepatide has become essential for comparative studies in metabolic research. Includes Certificate of Analysis. For research use only.

VIP (Vasoactive Intestinal Peptide) is a high-purity (≥99%) 28-amino acid neuropeptide with a molecular weight of 3326.8 Da. This regulatory peptide is studied in neuroendocrine, gastrointestinal, and immune function research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining vasodilation, circadian rhythms, and neurotransmitter pathways. For research use only.