Sequences investigated for antimicrobial activity in in-vitro laboratory conditions.
KPV is a high-purity (≥99%) tripeptide with a molecular weight of 357.4 Da, featuring the sequence Lys-Pro-Val. This C-terminal fragment of alpha-melanocyte stimulating hormone (α-MSH) is studied in inflammation and immune modulation research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining melanocortin signaling and anti-inflammatory pathways in laboratory settings. For research use only.
LL-37 is a high-purity (≥99%) human cathelicidin antimicrobial peptide with a molecular weight of 4493.3 Da. The 37-amino acid sequence [LL-37, 37 aa] is studied in immunology and host defense research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining antimicrobial activity, immune modulation, and wound healing pathways. For research use only.
Thymosin Alpha-1 is a high-purity (≥99%) 28-amino acid thymic peptide with a molecular weight of 3108.3 Da. The sequence Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN is studied in immunomodulation and immune system research. Supplied as a lyophilized powder, store at -20°C protected from light and moisture. Used for examining T-cell function and immune response pathways. For research use only.
Thymulin is a high-purity (≥99%) thymic nonapeptide with a molecular weight of 847.9 Da. The sequence pGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn requires zinc for biological activity and is studied in immune system research. Supplied as a lyophilized powder, store at -20°C protected from light. Used for examining T-cell differentiation and thymic function pathways. For research use only.
All products in this category are supplied exclusively for laboratory research purposes. These materials are not intended for human or veterinary use, diagnostic procedures, or clinical applications.
